PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF026200120CFD_t1
Common NameTRAES_3BF026200120CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 213aa    MW: 23922.6 Da    PI: 6.9615
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF026200120CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-171663148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd++lv ++ q+G g+W+  ar  g++R +k+c++rw++yl
  TRAES3BF026200120CFD_t1 16 KGPWTLEEDLILVGYISQHGEGSWDNLARSAGLNRNGKSCRLRWLNYL 63
                             79********************************************97 PP

2Myb_DNA-binding50.16.2e-1669112146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ ++eEd  + +++ +lG++ W+ Ia++++ gRt++++k++w++
  TRAES3BF026200120CFD_t1  69 RGSISPEEDMVIRELHSRLGNK-WAEIAKHLP-GRTDNEVKNYWRT 112
                              7888******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.131163IPR017930Myb domain
SuperFamilySSF466899.36E-3114110IPR009057Homeodomain-like
SMARTSM007178.7E-131565IPR001005SANT/Myb domain
PfamPF002499.9E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-201769IPR009057Homeodomain-like
CDDcd001675.55E-101863No hitNo description
PROSITE profilePS5129424.78264118IPR017930Myb domain
SMARTSM007178.6E-1568116IPR001005SANT/Myb domain
PfamPF002491.2E-1469112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2470117IPR009057Homeodomain-like
CDDcd001672.04E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MARMMCGRAG EPAVRKGPWT LEEDLILVGY ISQHGEGSWD NLARSAGLNR NGKSCRLRWL  60
NYLRPGLRRG SISPEEDMVI RELHSRLGNK WAEIAKHLPG RTDNEVKNYW RTRVHKKAPH  120
QNQFPAQPAS EATTSVSASA STSHASSTVG DEYTQTSFPY PELSWVATDH HETVDVGAPT  180
ARFFPSEFGG NFWNVPDNFW ETLPLSDPVY EAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-281211823128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566926.21e-112PREDICTED: myb-related protein 340
TrEMBLW5CZM01e-160W5CZM0_WHEAT; Uncharacterized protein
STRINGMLOC_5568.11e-125(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132402633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-56myb domain protein 21
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]